Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Methanococcus maripaludis Probable [NiFe]-hydrogenase-type-3 Eha complex membrane subunit A (ehaA)

This Recombinant Methanococcus maripaludis Probable [NiFe]-hydrogenase-type-3 Eha complex membrane subunit A (ehaA) spans the amino acid sequence from region 1-88.

Product Specifications

Product Name Alternative

Probable [NiFe]-hydrogenase-type-3 Eha complex membrane subunit A

UniProt

Q6LXA4

Expression Region

1-88

Origin

Methanococcus maripaludis (strain S2 / LL)

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MVLLINYAVSLVSAIVVGAVLGMKLSFDMDSFEGSVLFPTPFVAIGLTALIGYLITLDLV SSIIIGIFASVFSKFTNKIFPGVNNDIN

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Junctophilin 3 Polyclonal Antibody, APC Conjugated
bs-11083R-APC 100 µL

Junctophilin 3 Polyclonal Antibody, APC Conjugated

Sign In for Pricing
View Details
Rat Anti-Mouse CD45R/B220-SPRD
MBS673386-01 0.1 mg

Rat Anti-Mouse CD45R/B220-SPRD

Sign In for Pricing
View Details
Rat Anti-Mouse CD45R/B220-SPRD
MBS673386-02 5x 0.1 mg

Rat Anti-Mouse CD45R/B220-SPRD

Sign In for Pricing
View Details
Mouse Acid sphingomyelinase like phosphodiesterase 3A, SMPDL3A ELISA KIT
E1810Mo-01 48 Well

Mouse Acid sphingomyelinase like phosphodiesterase 3A, SMPDL3A ELISA KIT

Sign In for Pricing
View Details
Mouse Acid sphingomyelinase like phosphodiesterase 3A, SMPDL3A ELISA KIT
E1810Mo-02 96 Well

Mouse Acid sphingomyelinase like phosphodiesterase 3A, SMPDL3A ELISA KIT

Sign In for Pricing
View Details
Mouse Acid sphingomyelinase like phosphodiesterase 3A, SMPDL3A ELISA KIT
E1810Mo-03 5x 96 Tests

Mouse Acid sphingomyelinase like phosphodiesterase 3A, SMPDL3A ELISA KIT

Sign In for Pricing
View Details