Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Yop proteins translocation protein S (yscS)

This Recombinant Yop proteins translocation protein S (yscS) spans the amino acid sequence from region 1-88.

Product Specifications

Product Name Alternative

Yop proteins translocation protein S

UniProt

P69982

Expression Region

1-88

Origin

Yersinia pestis

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSQGDIIHFTSQALWLVLVLSMPPVLVAAVVGTLVSLVQALTQIQEQTLGFVIKLIAVVV TLFATASWLGNELHSFAEMTMMKIQGIR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

14-Chlorodehydroabietic Acid
TRC-C421856-25MG 25 mg

14-Chlorodehydroabietic Acid

Sign In for Pricing
View Details
Frozen Tissue Sections, Colon
CS620453 5x 5 µm

Frozen Tissue Sections, Colon

Sign In for Pricing
View Details
APC Anti-Human CD180 Antibody[MHR73-11]
AN00326E-01 20 Tests

APC Anti-Human CD180 Antibody[MHR73-11]

Sign In for Pricing
View Details
APC Anti-Human CD180 Antibody[MHR73-11]
AN00326E-02 100 Tests

APC Anti-Human CD180 Antibody[MHR73-11]

Sign In for Pricing
View Details
APC Anti-Human CD180 Antibody[MHR73-11]
AN00326E-03 2x 100 Tests

APC Anti-Human CD180 Antibody[MHR73-11]

Sign In for Pricing
View Details
CEP128 Rabbit Polyclonal Antibody
TA360898 100 µL

CEP128 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details