Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Yop proteins translocation protein S (yscS)

This Recombinant Yop proteins translocation protein S (yscS) spans the amino acid sequence from region 1-88.

Product Specifications

Product Name Alternative

Yop proteins translocation protein S

UniProt

P69982

Expression Region

1-88

Origin

Yersinia pestis

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSQGDIIHFTSQALWLVLVLSMPPVLVAAVVGTLVSLVQALTQIQEQTLGFVIKLIAVVV TLFATASWLGNELHSFAEMTMMKIQGIR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Droxinostat
TRC-D689890-250MG 250 mg

Droxinostat

Sign In for Pricing
View Details
4-Chloro-4'-fluorobutyrophenone-d4
TRC-C366347-50MG 50 mg

4-Chloro-4'-fluorobutyrophenone-d4

Sign In for Pricing
View Details
Mouse Meox2 activation kit by CRISPRa
GA202638 1 Kit

Mouse Meox2 activation kit by CRISPRa

Sign In for Pricing
View Details
Recombinant Mouse CDCP1/CD318 Protein (Fc Tag)
PKSM040351 100 µg

Recombinant Mouse CDCP1/CD318 Protein (Fc Tag)

Sign In for Pricing
View Details
Elastin (ELN) (Marker of Arterial Stiffness and Atherosclerosis) (ELN/1981), 1mg/mL
BNUM1981-50 1x 50 µL

Elastin (ELN) (Marker of Arterial Stiffness and Atherosclerosis) (ELN/1981), 1mg/mL

Sign In for Pricing
View Details
Bfsp2 Mouse Gene Knockout Kit (CRISPR)
KN502149 1 Kit

Bfsp2 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details