Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Yop proteins translocation protein S (yscS)

This Recombinant Yop proteins translocation protein S (yscS) spans the amino acid sequence from region 1-88.

Product Specifications

Product Name Alternative

Yop proteins translocation protein S

UniProt

P69983

Expression Region

1-88

Origin

Yersinia pseudotuberculosis

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSQGDIIHFTSQALWLVLVLSMPPVLVAAVVGTLVSLVQALTQIQEQTLGFVIKLIAVVV TLFATASWLGNELHSFAEMTMMKIQGIR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ICAM1 Mouse Monoclonal Antibody [Clone ID: B-H17]
AM31187AF-N 200 µg

ICAM1 Mouse Monoclonal Antibody [Clone ID: B-H17]

Sign In for Pricing
View Details
RAGE (AGER) (NM_001136) Human Recombinant Protein
TP720357M 50 µg

RAGE (AGER) (NM_001136) Human Recombinant Protein

Sign In for Pricing
View Details
ZFYVE27 (NM_001174121) Human Over-expression Lysate
LC432865 20 µg

ZFYVE27 (NM_001174121) Human Over-expression Lysate

Sign In for Pricing
View Details
ATP11B Polyclonal Antibody
E-AB-90372-01 60 µL

ATP11B Polyclonal Antibody

Sign In for Pricing
View Details
ATP11B Polyclonal Antibody
E-AB-90372-02 120 µL

ATP11B Polyclonal Antibody

Sign In for Pricing
View Details
ATP11B Polyclonal Antibody
E-AB-90372-03 200 µL

ATP11B Polyclonal Antibody

Sign In for Pricing
View Details