Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Murine coronavirus Envelope small membrane protein (E)

This Recombinant Murine coronavirus Envelope small membrane protein (E) spans the amino acid sequence from region 1-88.

Product Specifications

Product Name Alternative

Envelope small membrane protein, E protein, sM protein

UniProt

P29076

Expression Region

1-88

Origin

Murine coronavirus (strain S) (MHV-S) (Murine hepatitis virus)

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MFNLFLTDTVWYVGQIIFIVAVCLMVTITVVAFLASIKLCIQLCGLCNTLVLSPSIYLYD RSKQLYKYYNEEVRPPPLEVDDIIIQTL

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rat MRPL16 siRNA
abx924587-01 15 nmol

Rat MRPL16 siRNA

Sign In for Pricing
View Details
Rat MRPL16 siRNA
abx924587-02 30 nmol

Rat MRPL16 siRNA

Sign In for Pricing
View Details
LINC00419 Protein Vector (Human) (pPM-C-HA)
26739021 500 ng

LINC00419 Protein Vector (Human) (pPM-C-HA)

Sign In for Pricing
View Details
EDG-3 CRISPR/Cas9 KO Plasmid (h)
sc-401366 20 µg

EDG-3 CRISPR/Cas9 KO Plasmid (h)

Sign In for Pricing
View Details
Bombyx Mori Livetin (LT) ELISA Kit
AE62927BM-01 48 Tests

Bombyx Mori Livetin (LT) ELISA Kit

Sign In for Pricing
View Details
Bombyx Mori Livetin (LT) ELISA Kit
AE62927BM-02 96 Tests

Bombyx Mori Livetin (LT) ELISA Kit

Sign In for Pricing
View Details