Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Murine coronavirus Envelope small membrane protein (E)

This Recombinant Murine coronavirus Envelope small membrane protein (E) spans the amino acid sequence from region 1-88.

Product Specifications

Product Name Alternative

Envelope small membrane protein, E protein, sM protein

UniProt

P29076

Expression Region

1-88

Origin

Murine coronavirus (strain S) (MHV-S) (Murine hepatitis virus)

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MFNLFLTDTVWYVGQIIFIVAVCLMVTITVVAFLASIKLCIQLCGLCNTLVLSPSIYLYD RSKQLYKYYNEEVRPPPLEVDDIIIQTL

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rgs3 Mouse qPCR Primer Pair (NM_134257)
MP221383 200 Reactions

Rgs3 Mouse qPCR Primer Pair (NM_134257)

Sign In for Pricing
View Details
[Cys0]-LGR8 (737-754) (Human)
001-54 100 µg

[Cys0]-LGR8 (737-754) (Human)

Sign In for Pricing
View Details
Quincorine
sc-296167A 1 g

Quincorine

Sign In for Pricing
View Details
EEF1A1P6 3'UTR Luciferase Stable Cell Line
TU006579 1.0 mL

EEF1A1P6 3'UTR Luciferase Stable Cell Line

Sign In for Pricing
View Details
Recombinant Human CKAP4, GST-tagged
CKAP4-11261H 25 µg

Recombinant Human CKAP4, GST-tagged

Sign In for Pricing
View Details
Ctc1 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Rat)
17043116 3x 1.0 µg

Ctc1 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Rat)

Sign In for Pricing
View Details