Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Flagellar biosynthetic protein FliQ (fliQ)

This Recombinant Flagellar biosynthetic protein FliQ (fliQ) spans the amino acid sequence from region 1-89.

Product Specifications

Product Name Alternative

Flagellar biosynthetic protein FliQ

UniProt

P0AC09

Expression Region

1-89

Origin

Escherichia coli O157:H7

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MTPESVMMMGTEAMKVALALAAPLLLVALVTGLIISILQAATQINEMTLSFIPKIIAVFI AIIIAGPWMLNLLLDYVRTLFTNLPYIIG

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD14 (Monocyte / Macrophage Marker) (LPSR/2386), Biotin conjugate, 0.1mg/mL
BNCB2386-100 1x 100 µL

CD14 (Monocyte / Macrophage Marker) (LPSR/2386), Biotin conjugate, 0.1mg/mL

Sign In for Pricing
View Details
RNF11 Rabbit Polyclonal Antibody
TA380965 100 µL

RNF11 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
4-Bromobenzotrifluoride
TRC-B680525-5G 5 g

4-Bromobenzotrifluoride

Sign In for Pricing
View Details
Human S100B (S100 Calcium Binding Protein B) ELISA Kit
E-EL-H1297-01 24 Tests

Human S100B (S100 Calcium Binding Protein B) ELISA Kit

Sign In for Pricing
View Details
Human S100B (S100 Calcium Binding Protein B) ELISA Kit
E-EL-H1297-02 48 Tests

Human S100B (S100 Calcium Binding Protein B) ELISA Kit

Sign In for Pricing
View Details
Human S100B (S100 Calcium Binding Protein B) ELISA Kit
E-EL-H1297-03 96 Tests

Human S100B (S100 Calcium Binding Protein B) ELISA Kit

Sign In for Pricing
View Details