Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Verminephrobacter eiseniae ATP synthase subunit c (atpE)

This Recombinant Verminephrobacter eiseniae ATP synthase subunit c (atpE) spans the amino acid sequence from region 1-89.

Product Specifications

Product Name Alternative

ATP synthase subunit c, ATP synthase F (0) sector subunit c, F-type ATPase subunit c, F-ATPase subunit c, Lipid-binding protein

UniProt

A1WF53

Expression Region

1-89

Origin

Verminephrobacter eiseniae (strain EF01-2)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MEIILGFVALACGLIVGLGAIGASIGIGLMGGKFLESSARQPELINELQTKMFILAGLID AAFLIGVAIALMFAFANPFVSTLLANMPK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Human ACP5/TRAP Protein (His Tag)
PKSH031534 20 µg

Recombinant Human ACP5/TRAP Protein (His Tag)

Sign In for Pricing
View Details
HCLS1 Recombinant Rabbit monoclonal Antibody
HA750688 100 µL

HCLS1 Recombinant Rabbit monoclonal Antibody

Sign In for Pricing
View Details
MemBrite® Fix 640/660 Cell Surface Staining Kit, 100 Reactions
#30097-T 1 Kit

MemBrite® Fix 640/660 Cell Surface Staining Kit, 100 Reactions

Sign In for Pricing
View Details
N-(2,2,2-Trichloroethoxy)carbonyl] Nortilidine
TRC-T774170-10MG 10 mg

N-(2,2,2-Trichloroethoxy)carbonyl] Nortilidine

Sign In for Pricing
View Details
AP1B1 Polyclonal Antibody
E-AB-12971-01 20 µL

AP1B1 Polyclonal Antibody

Sign In for Pricing
View Details
AP1B1 Polyclonal Antibody
E-AB-12971-02 60 µL

AP1B1 Polyclonal Antibody

Sign In for Pricing
View Details