Recombinant Prochlorococcus marinus NAD (P) H-quinone oxidoreductase subunit L
This Recombinant Prochlorococcus marinus NAD (P) H-quinone oxidoreductase subunit L spans the amino acid sequence from region 1-89.
Product Specifications
Product Name Alternative
NAD (P) H-quinone oxidoreductase subunit L, EC= 1.6.5.-, NAD (P) H dehydrogenase I subunit L, NDH-1 subunit L, NDH-L
UniProt
A2C127
Expression Region
1-89
Origin
Prochlorococcus marinus (strain NATL1A)
Form
Lyophilized powder
Storage Conditions
Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week
Notes
For research use only.
Preservative
Tris/PBS-based buffer, 6% Trehalose, pH 8.0
AA Sequence
MSLISIVCLIPFGLIGAVNPIITLSAYAVLGGMYLFVVPLFLFYWMNNRWNVMGKFERLF IYGLVFLFFPGMVLFAPFLNLRMNGKEES
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNC680633-100 1x 100 µL
Von Willebrand Factor (3E2D10), CF568 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC040630-500 1x 500 µL
Mucin 1 / EMA / Episialin / CD227 (VU-2G7), CF405S conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC040146-500 1x 500 µL
CD10 (CB-CALLA), CF405S conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC941073-500 1x 500 µL
HLA-Aw32 & HLA-A25 (MHC I) (CATA-1), CF594 conjugate, 0.1mg/mL
Sign In for Pricing
View Details