Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Bacillus subtilis Uncharacterized protein ykoA (ykoA)

This Recombinant Bacillus subtilis Uncharacterized protein ykoA (ykoA) spans the amino acid sequence from region 1-89.

Product Specifications

Product Name Alternative

Uncharacterized protein ykoA

UniProt

O31715

Expression Region

1-89

Origin

Bacillus subtilis (strain 168)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MRLLTLTEYCLLIFFTGFYLAVTGFTAKDIGLYIGIALIYIFSHIFSKRLLEKRGKENKQ VHLFFSVLAIIGSVFITVLCIALVASFSK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Phospho-Tau (Ser422) Rabbit Polyclonal Antibody (PerCP)
orb2429379 100 µL

Phospho-Tau (Ser422) Rabbit Polyclonal Antibody (PerCP)

Sign In for Pricing
View Details
Platelet Derived Growth Factor Receptor alpha (PDGFRa)
P4258-26 200 µL

Platelet Derived Growth Factor Receptor alpha (PDGFRa)

Sign In for Pricing
View Details
Dextofisopam
HY-106615 1 Each

Dextofisopam

Sign In for Pricing
View Details
3-Amino-4-sulfanylbenzene-1-sulfonamide hydrochloride
FA184023-01 5 mg

3-Amino-4-sulfanylbenzene-1-sulfonamide hydrochloride

Sign In for Pricing
View Details
3-Amino-4-sulfanylbenzene-1-sulfonamide hydrochloride
FA184023-02 10 mg

3-Amino-4-sulfanylbenzene-1-sulfonamide hydrochloride

Sign In for Pricing
View Details
3-Amino-4-sulfanylbenzene-1-sulfonamide hydrochloride
FA184023-03 25 mg

3-Amino-4-sulfanylbenzene-1-sulfonamide hydrochloride

Sign In for Pricing
View Details