Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Archaeoglobus fulgidus Uncharacterized protein AF_0752 (AF_0752)

This Recombinant Archaeoglobus fulgidus Uncharacterized protein AF_0752 (AF_0752) spans the amino acid sequence from region 1-89.

Product Specifications

Product Name Alternative

Uncharacterized protein AF_0752

UniProt

O29506

Expression Region

1-89

Origin

Archaeoglobus fulgidus (strain ATCC 49558 / VC-16 / DSM 4304 / JCM 9628 / NBRC 100126)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MKLSIADFEEWLRERGYDLMMGEQNFRLYLDLGFSALLFYNSNLLFSFILDKVGLKSADE RVPDRLRFEIAKRLRRIEATKDEIEIELL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

1,1-Diisopropoxycyclohexane
TRC-D525430-50MG 50 mg

1,1-Diisopropoxycyclohexane

Sign In for Pricing
View Details
Repulsive Guidance Molecule C (HFE2) Mouse Monoclonal Antibody [Clone ID: OTI4E2]
CF809328 100 µg

Repulsive Guidance Molecule C (HFE2) Mouse Monoclonal Antibody [Clone ID: OTI4E2]

Sign In for Pricing
View Details
Bisphenol AP
TRC-B519485-5G 5 g

Bisphenol AP

Sign In for Pricing
View Details
ILF3 Recombinant Rabbit Monoclonal Antibody [JG37-63]
ET7108-49 100 µL

ILF3 Recombinant Rabbit Monoclonal Antibody [JG37-63]

Sign In for Pricing
View Details
Frozen Tissue Sections, Kidney
CS504936 5x 5 µm

Frozen Tissue Sections, Kidney

Sign In for Pricing
View Details
Recombinant Human GFER Protein (His Tag)
PKSH032412-01 10 µg

Recombinant Human GFER Protein (His Tag)

Sign In for Pricing
View Details