Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Archaeoglobus fulgidus Uncharacterized protein AF_0752 (AF_0752)

This Recombinant Archaeoglobus fulgidus Uncharacterized protein AF_0752 (AF_0752) spans the amino acid sequence from region 1-89.

Product Specifications

Product Name Alternative

Uncharacterized protein AF_0752

UniProt

O29506

Expression Region

1-89

Origin

Archaeoglobus fulgidus (strain ATCC 49558 / VC-16 / DSM 4304 / JCM 9628 / NBRC 100126)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MKLSIADFEEWLRERGYDLMMGEQNFRLYLDLGFSALLFYNSNLLFSFILDKVGLKSADE RVPDRLRFEIAKRLRRIEATKDEIEIELL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Di-n-heptyl Phthalate
163720-01 1 g

Di-n-heptyl Phthalate

Sign In for Pricing
View Details
Di-n-heptyl Phthalate
163720-02 10 g

Di-n-heptyl Phthalate

Sign In for Pricing
View Details
Di-n-heptyl Phthalate
163720-03 50 g

Di-n-heptyl Phthalate

Sign In for Pricing
View Details
Napropamide M
TRC-N343910-25MG 25 mg

Napropamide M

Sign In for Pricing
View Details
AAV Purification Midi Kit
63300 4 Preparations

AAV Purification Midi Kit

Sign In for Pricing
View Details
Mta2 sgRNA CRISPR Lentivector (Rat) (Target 1)
K6372002 1.0 µg DNA

Mta2 sgRNA CRISPR Lentivector (Rat) (Target 1)

Sign In for Pricing
View Details