Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Archaeoglobus fulgidus Uncharacterized protein AF_0752 (AF_0752)

This Recombinant Archaeoglobus fulgidus Uncharacterized protein AF_0752 (AF_0752) spans the amino acid sequence from region 1-89.

Product Specifications

Product Name Alternative

Uncharacterized protein AF_0752

UniProt

O29506

Expression Region

1-89

Origin

Archaeoglobus fulgidus (strain ATCC 49558 / VC-16 / DSM 4304 / JCM 9628 / NBRC 100126)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MKLSIADFEEWLRERGYDLMMGEQNFRLYLDLGFSALLFYNSNLLFSFILDKVGLKSADE RVPDRLRFEIAKRLRRIEATKDEIEIELL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

HHIP Polyclonal Antibody, PE Conjugated
bs-12316R-PE 100 µL

HHIP Polyclonal Antibody, PE Conjugated

Sign In for Pricing
View Details
Rabbit Polyclonal ATG14 Antibody [Alexa Fluor 647]
NBP2-36445AF647 0.1 mL

Rabbit Polyclonal ATG14 Antibody [Alexa Fluor 647]

Sign In for Pricing
View Details
UCH37, NT (Ubiquitin Carboxyl-terminal Hydrolase Isozyme L5, Ubiquitin Thiolesterase L5, Ubiquitin C-terminal Hydrolase UCH37, CGI-70, AD-019, UCHL5) (FITC)
MBS6504697-01 0.2 mL

UCH37, NT (Ubiquitin Carboxyl-terminal Hydrolase Isozyme L5, Ubiquitin Thiolesterase L5, Ubiquitin C-terminal Hydrolase UCH37, CGI-70, AD-019, UCHL5) (FITC)

Sign In for Pricing
View Details
UCH37, NT (Ubiquitin Carboxyl-terminal Hydrolase Isozyme L5, Ubiquitin Thiolesterase L5, Ubiquitin C-terminal Hydrolase UCH37, CGI-70, AD-019, UCHL5) (FITC)
MBS6504697-02 5x 0.2 mL

UCH37, NT (Ubiquitin Carboxyl-terminal Hydrolase Isozyme L5, Ubiquitin Thiolesterase L5, Ubiquitin C-terminal Hydrolase UCH37, CGI-70, AD-019, UCHL5) (FITC)

Sign In for Pricing
View Details
ARPC2 (Actin Related Protein 2/3 Complex Subunit 2 34kD, ARC34, PRO2446, p34-Arc, PNAS-139, ARP2/3 Protein Compex Subunit 34) (AP)
MBS6130072-01 0.1 mL

ARPC2 (Actin Related Protein 2/3 Complex Subunit 2 34kD, ARC34, PRO2446, p34-Arc, PNAS-139, ARP2/3 Protein Compex Subunit 34) (AP)

Sign In for Pricing
View Details
ARPC2 (Actin Related Protein 2/3 Complex Subunit 2 34kD, ARC34, PRO2446, p34-Arc, PNAS-139, ARP2/3 Protein Compex Subunit 34) (AP)
MBS6130072-02 5x 0.1 mL

ARPC2 (Actin Related Protein 2/3 Complex Subunit 2 34kD, ARC34, PRO2446, p34-Arc, PNAS-139, ARP2/3 Protein Compex Subunit 34) (AP)

Sign In for Pricing
View Details