Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Methanocaldococcus jannaschii Uncharacterized protein MJ0792 (MJ0792)

This Recombinant Methanocaldococcus jannaschii Uncharacterized protein MJ0792 (MJ0792) spans the amino acid sequence from region 1-89.

Product Specifications

Product Name Alternative

Uncharacterized protein MJ0792

UniProt

Q58202

Expression Region

1-89

Origin

Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) (Methanococcus jannaschii)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MKFLEKGVYKIFGAVILVSMIGALVAEPIALGDAGLYYQYYVGDIDTAQQCYLVAADSAI TGAAISAALGPAGLASGVFTVVFSTTVLA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

2,2'-(Oleylamino)diethanol
TRC-O253070-50MG 50 mg

2,2'-(Oleylamino)diethanol

Sign In for Pricing
View Details
Tenocyclidine Hydrochloride
TRC-T018450-1MG 1 mg

Tenocyclidine Hydrochloride

Sign In for Pricing
View Details
Diethyl 5-Ethylpyridine-2,3-dicarboxylate
TRC-D444560-25G 25 g

Diethyl 5-Ethylpyridine-2,3-dicarboxylate

Sign In for Pricing
View Details
ZNF132 (NM_003433) Human Recombinant Protein
TP760874 50 µg

ZNF132 (NM_003433) Human Recombinant Protein

Sign In for Pricing
View Details
BARX1 (Prognostic Biomarker in Hepatocellular Carcinoma) (BARX1/2760), 1mg/mL
BNUM2760-50 1x 50 µL

BARX1 (Prognostic Biomarker in Hepatocellular Carcinoma) (BARX1/2760), 1mg/mL

Sign In for Pricing
View Details
Human PRR5-ARHGAP8 activation kit by CRISPRa
GA118627 1 Kit

Human PRR5-ARHGAP8 activation kit by CRISPRa

Sign In for Pricing
View Details