Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human herpesvirus 2 Envelope protein US9 (US9)

This Recombinant Human herpesvirus 2 Envelope protein US9 (US9) spans the amino acid sequence from region 1-89.

Product Specifications

Product Name Alternative

Envelope protein US9, 10 kDa protein

UniProt

P89477

Expression Region

1-89

Origin

Human herpesvirus 2 (strain HG52) (HHV-2) (Human herpes simplex virus 2)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MTSRPADQDSVRSSASVPLYPAASPVPAEAYYSESEDEAANDFLVRMGRQQSVLRRRRRR TRCVGLVIACLVVALLSGGFGALLVWLLR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Porcine soluble Vascuolar cell adhesion molecule 1 (sVCAM-1) ELISA Kit
YP-W80752-01 48 Tests

Porcine soluble Vascuolar cell adhesion molecule 1 (sVCAM-1) ELISA Kit

Sign In for Pricing
View Details
Porcine soluble Vascuolar cell adhesion molecule 1 (sVCAM-1) ELISA Kit
YP-W80752-02 96 Tests

Porcine soluble Vascuolar cell adhesion molecule 1 (sVCAM-1) ELISA Kit

Sign In for Pricing
View Details
RIOK3 Antibody : Biotin (OAAF04253-Biotin)
OAAF04253-100UG-Biotin 100 µg

RIOK3 Antibody : Biotin (OAAF04253-Biotin)

Sign In for Pricing
View Details
3-Bromo-2-hydroxy-5-methylbenzoic acid
OR1057494-01 100 mg

3-Bromo-2-hydroxy-5-methylbenzoic acid

Sign In for Pricing
View Details
3-Bromo-2-hydroxy-5-methylbenzoic acid
OR1057494-02 250 mg

3-Bromo-2-hydroxy-5-methylbenzoic acid

Sign In for Pricing
View Details
3-Bromo-2-hydroxy-5-methylbenzoic acid
OR1057494-03 1 g

3-Bromo-2-hydroxy-5-methylbenzoic acid

Sign In for Pricing
View Details