Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant ATP synthase subunit c, sodium ion specific (atpE)

This Recombinant ATP synthase subunit c, sodium ion specific (atpE) spans the amino acid sequence from region 1-89.

Product Specifications

Product Name Alternative

ATP synthase subunit c, sodium ion specific, ATP synthase F (0) sector subunit c, F-type ATPase subunit c, F-ATPase subunit c, Lipid-binding protein

UniProt

P21905

Expression Region

1-89

Origin

Propionigenium modestum

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MDMVLAKTVVLAASAVGAGAAMIAGIGPGVGQGYAAGKAVESVARQPEAKGDIISTMVLG QAIAESTGIYSLVIALILLYANPFVGLLG

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Salicylaldehyde-13C6
TRC-S088146-25MG 25 mg

Salicylaldehyde-13C6

Sign In for Pricing
View Details
Lentiviral mouse Ubr5 shRNA (UAS) - Lentiviral mouse Ubr5 shRNA (UAS, GFP) (100)
GTR15275601 1 Vial

Lentiviral mouse Ubr5 shRNA (UAS) - Lentiviral mouse Ubr5 shRNA (UAS, GFP) (100)

Sign In for Pricing
View Details
GPR88 Polyclonal Antibody
JOT-AP15773-01 20 µL

GPR88 Polyclonal Antibody

Sign In for Pricing
View Details
GPR88 Polyclonal Antibody
JOT-AP15773-02 50 μL

GPR88 Polyclonal Antibody

Sign In for Pricing
View Details
GPR88 Polyclonal Antibody
JOT-AP15773-03 100 µL

GPR88 Polyclonal Antibody

Sign In for Pricing
View Details
Eotaxin 3 (CCL26) (NM_006072) Human Over-expression Lysate
LC401828 20 µg

Eotaxin 3 (CCL26) (NM_006072) Human Over-expression Lysate

Sign In for Pricing
View Details