Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human herpesvirus 1 Envelope protein US9 (US9)

This Recombinant Human herpesvirus 1 Envelope protein US9 (US9) spans the amino acid sequence from region 1-90.

Product Specifications

Product Name Alternative

Envelope protein US9, 10 kDa protein

UniProt

P06481

Expression Region

1-90

Origin

Human herpesvirus 1 (strain 17) (HHV-1) (Human herpes simplex virus 1)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MTSRLSDPNSSARSDMSVPLYPTASPVSVEAYYSESEDEAANDFLVRMGRQQSVLRRRRR RTRCVGMVIACLLVAVLSGGFGALLMWLLR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Tumor protein p53-inducible protein 13 (TP53I13) Human ELISA Kit
H9531 96 Tests

Tumor protein p53-inducible protein 13 (TP53I13) Human ELISA Kit

Sign In for Pricing
View Details
Angiopoietin-like-Protein-1 Mouse Monoclonal Antibody
orb1153697 100 µg

Angiopoietin-like-Protein-1 Mouse Monoclonal Antibody

Sign In for Pricing
View Details
Rat Cytochrome P450 1A1 (CYP1A1) ELISA Kit
RDR-CYP1A1-Ra-01 96 Tests

Rat Cytochrome P450 1A1 (CYP1A1) ELISA Kit

Sign In for Pricing
View Details
Rat Cytochrome P450 1A1 (CYP1A1) ELISA Kit
RDR-CYP1A1-Ra-02 48 Tests

Rat Cytochrome P450 1A1 (CYP1A1) ELISA Kit

Sign In for Pricing
View Details
Lentiviral mouse Taar4 shRNA (UAS) - Lentiviral mouse Taar4 shRNA (UAS) plasmid
GTR15301642 1 Vial

Lentiviral mouse Taar4 shRNA (UAS) - Lentiviral mouse Taar4 shRNA (UAS) plasmid

Sign In for Pricing
View Details
RIP3 Antibody (YA6043, Rabbit)
HY-P86351-01 10 µL

RIP3 Antibody (YA6043, Rabbit)

Sign In for Pricing
View Details