Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human herpesvirus 1 Envelope protein US9 (US9)

This Recombinant Human herpesvirus 1 Envelope protein US9 (US9) spans the amino acid sequence from region 1-90.

Product Specifications

Product Name Alternative

Envelope protein US9, 10 kDa protein

UniProt

P06481

Expression Region

1-90

Origin

Human herpesvirus 1 (strain 17) (HHV-1) (Human herpes simplex virus 1)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MTSRLSDPNSSARSDMSVPLYPTASPVSVEAYYSESEDEAANDFLVRMGRQQSVLRRRRR RTRCVGMVIACLLVAVLSGGFGALLMWLLR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CCDC30 Double Nickase Plasmid (h)
sc-416177-NIC 20 µg

CCDC30 Double Nickase Plasmid (h)

Sign In for Pricing
View Details
Anti-Human PCP4 Polyclonal Antibody
PHE58501 100 μg

Anti-Human PCP4 Polyclonal Antibody

Sign In for Pricing
View Details
NFKBID Recombinant Protein
OPCD04216-200UG 200 µg

NFKBID Recombinant Protein

Sign In for Pricing
View Details
Slit Homolog 2 (Slit2) Magnetic Fluorescence Assay Kit
MBS2156058-01 96 Tests

Slit Homolog 2 (Slit2) Magnetic Fluorescence Assay Kit

Sign In for Pricing
View Details
Slit Homolog 2 (Slit2) Magnetic Fluorescence Assay Kit
MBS2156058-02 5x 96 Tests

Slit Homolog 2 (Slit2) Magnetic Fluorescence Assay Kit

Sign In for Pricing
View Details
Slit Homolog 2 (Slit2) Magnetic Fluorescence Assay Kit
MBS2156058-03 10x 96 Tests

Slit Homolog 2 (Slit2) Magnetic Fluorescence Assay Kit

Sign In for Pricing
View Details