Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Wheat dwarf virus Movement protein (V2)

This Recombinant Wheat dwarf virus Movement protein (V2) spans the amino acid sequence from region 1-90.

Product Specifications

Product Name Alternative

Movement protein, MP

UniProt

P06849

Expression Region

1-90

Origin

Wheat dwarf virus (isolate Sweden) (WDV)

Field of Research

Infectious Disease & Virology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MEQAIAPPLPIRDYQYQTPSIPGSSDYAWRTFVFVTFGLLIAVGVAWLAYTLFLKDLILV CKAKKQRRTEEIGYGNTPARLNGDQQGLPR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

IL 17 Human, HEK
OM296704-01 10 µg

IL 17 Human, HEK

Sign In for Pricing
View Details
IL 17 Human, HEK
OM296704-02 2 µg

IL 17 Human, HEK

Sign In for Pricing
View Details
IL 17 Human, HEK
OM296704-03 1 mg

IL 17 Human, HEK

Sign In for Pricing
View Details
NAA40 (NM_001300800) Human Tagged ORF Clone
RG236637 10 µg

NAA40 (NM_001300800) Human Tagged ORF Clone

Sign In for Pricing
View Details
Chromogranin A / CHGA (Neuroendocrine Marker), 0.2mg/mL
BNUB1774-500 1x 500 µL

Chromogranin A / CHGA (Neuroendocrine Marker), 0.2mg/mL

Sign In for Pricing
View Details
Sun2 Mouse Gene Knockout Kit (CRISPR)
KN516984 1 Kit

Sun2 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details