Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Pseudomonas phage phi6 Major envelope protein (P9)

This Recombinant Pseudomonas phage phi6 Major envelope protein (P9) spans the amino acid sequence from region 1-90.

Product Specifications

Product Name Alternative

Major envelope protein, Protein P9

UniProt

P07581

Expression Region

1-90

Origin

Pseudomonas phage phi6 (Bacteriophage phi-6)

Field of Research

Infectious Disease & Virology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MPFPLVKQDPTSKAFTEASERSTGTQILDVVKAPIGLFGDDAKHEFVTRQEQAVSVVSWA VAAGLIGELIGYRGARSGRKAILANIPFLA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

1-tert-Butyl-6-chloro-1H,4H,5H-pyrazolo[3,4-d]pyrimidin-4-one
CMB83801-01 250 mg

1-tert-Butyl-6-chloro-1H,4H,5H-pyrazolo[3,4-d]pyrimidin-4-one

Sign In for Pricing
View Details
1-tert-Butyl-6-chloro-1H,4H,5H-pyrazolo[3,4-d]pyrimidin-4-one
CMB83801-02 2.5 g

1-tert-Butyl-6-chloro-1H,4H,5H-pyrazolo[3,4-d]pyrimidin-4-one

Sign In for Pricing
View Details
Mouse pyridinoline (PYD) ELISA Kit
CSB-E15010m-01 96 Tests

Mouse pyridinoline (PYD) ELISA Kit

Sign In for Pricing
View Details
Mouse pyridinoline (PYD) ELISA Kit
CSB-E15010m-02 5x 96 Tests

Mouse pyridinoline (PYD) ELISA Kit

Sign In for Pricing
View Details
Mouse pyridinoline (PYD) ELISA Kit
CSB-E15010m-03 10x 96 Tests

Mouse pyridinoline (PYD) ELISA Kit

Sign In for Pricing
View Details
PGM1 Rabbit pAb
orb2718380-01 50 µL

PGM1 Rabbit pAb

Sign In for Pricing
View Details