Recombinant Pseudomonas phage phi6 Major envelope protein (P9)
This Recombinant Pseudomonas phage phi6 Major envelope protein (P9) spans the amino acid sequence from region 1-90.
Product Specifications
Product Name Alternative
Major envelope protein, Protein P9
UniProt
P07581
Expression Region
1-90
Origin
Pseudomonas phage phi6 (Bacteriophage phi-6)
Field of Research
Infectious Disease & Virology
Form
Lyophilized powder
Storage Conditions
Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week
Notes
For research use only.
Preservative
Tris/PBS-based buffer, 6% Trehalose, pH 8.0
AA Sequence
MPFPLVKQDPTSKAFTEASERSTGTQILDVVKAPIGLFGDDAKHEFVTRQEQAVSVVSWA VAAGLIGELIGYRGARSGRKAILANIPFLA
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
039064-ML405 100 µL
NOSTRIN, ID (NOSTRIN, Nostrin, BM247 homolog, Nitric oxide synthase traffic inducer, Nitric oxide synthase trafficker, eNOS-trafficking inducer) (MaxLight 405) discontinued
Sign In for Pricing
View Details 