Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Scheffersomyces stipitis Cytochrome oxidase assembly protein 3, mitochondrial (COA3)

This Recombinant Scheffersomyces stipitis Cytochrome oxidase assembly protein 3, mitochondrial (COA3) spans the amino acid sequence from region 1-90.

Product Specifications

Product Name Alternative

Cytochrome oxidase assembly protein 3, mitochondrial

UniProt

A3LWK1

Expression Region

1-90

Origin

Scheffersomyces stipitis (strain ATCC 58785 / CBS 6054 / NBRC 10063 / NRRL Y-11545) (Yeast) (Pichia stipitis)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MAVIGAPKGHDRYRDPKTHQMTPALYRVRAPFFWKNTIGLAICTAIPLGVYMYTLHMLSK DEFGDIPIPPISDTELTKLKKEYEASKNQN

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ACTH (Adrenocorticotrophic Hormone) (AH26), CF594 conjugate, 0.1mg/mL
BNC940026-100 1x 100 µL

ACTH (Adrenocorticotrophic Hormone) (AH26), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD171 / L1CAM (L1 Cell Adhesion Molecule) (UJ127), CF488A conjugate, 0.1mg/mL
BNC880679-500 1x 500 µL

CD171 / L1CAM (L1 Cell Adhesion Molecule) (UJ127), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD47 (IAP/964), CF405S conjugate, 0.1mg/mL
BNC040964-100 1x 100 µL

CD47 (IAP/964), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Mucin 5AC (MUC5AC) (MUC5AC/917), CF740 conjugate, 0.1mg/mL
BNC740917-500 1x 500 µL

Mucin 5AC (MUC5AC) (MUC5AC/917), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD44v9 (Marker of Tumor Metastasis) (CD44v9/2344R), CF568 conjugate, 0.1mg/mL
BNC682344-500 1x 500 µL

CD44v9 (Marker of Tumor Metastasis) (CD44v9/2344R), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
MiTF (Microphthalmia Transcription Factor) (D5 + MITF/915), CF594 conjugate, 0.1mg/mL
BNC940950-500 1x 500 µL

MiTF (Microphthalmia Transcription Factor) (D5 + MITF/915), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details