Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Bacillus subtilis Uncharacterized membrane protein ylmG (ylmG)

This Recombinant Bacillus subtilis Uncharacterized membrane protein ylmG (ylmG) spans the amino acid sequence from region 1-90.

Product Specifications

Product Name Alternative

Uncharacterized membrane protein ylmG

UniProt

O31729

Expression Region

1-90

Origin

Bacillus subtilis (strain 168)

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MILYQVFSVLSLLITIYSFALIIYIFMSWVPSTRETAVGRFLASICEPYLEPFRKIIPPI AMLDISPIVAILVLRFATTGLWGLYRMIAF

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Gelsolin (GSN) (Isoform a) Goat Polyclonal Antibody
AP31939PU-N 100 µg

Gelsolin (GSN) (Isoform a) Goat Polyclonal Antibody

Sign In for Pricing
View Details
NPRL3 Human Gene Knockout Kit (CRISPR)
KN200905LP 1 Kit

NPRL3 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Enramycin A
TRC-E556040-5MG 5 mg

Enramycin A

Sign In for Pricing
View Details
Osteopontin (SPP1) Mouse Monoclonal Antibody [Clone ID: OTI6C12]
CF806238 100 µg

Osteopontin (SPP1) Mouse Monoclonal Antibody [Clone ID: OTI6C12]

Sign In for Pricing
View Details
FITC Anti-Human CD244 Antibody[C1.7]
E-AB-F1374C-01 20 Tests

FITC Anti-Human CD244 Antibody[C1.7]

Sign In for Pricing
View Details
FITC Anti-Human CD244 Antibody[C1.7]
E-AB-F1374C-02 100 Tests

FITC Anti-Human CD244 Antibody[C1.7]

Sign In for Pricing
View Details