Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Bacillus subtilis Uncharacterized membrane protein ylmG (ylmG)

This Recombinant Bacillus subtilis Uncharacterized membrane protein ylmG (ylmG) spans the amino acid sequence from region 1-90.

Product Specifications

Product Name Alternative

Uncharacterized membrane protein ylmG

UniProt

O31729

Expression Region

1-90

Origin

Bacillus subtilis (strain 168)

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MILYQVFSVLSLLITIYSFALIIYIFMSWVPSTRETAVGRFLASICEPYLEPFRKIIPPI AMLDISPIVAILVLRFATTGLWGLYRMIAF

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

LOX 1 (OLR1) (NM_001172632) Human Recombinant Protein
TP720433L 500 µg

LOX 1 (OLR1) (NM_001172632) Human Recombinant Protein

Sign In for Pricing
View Details
Recombinant MAP3K2 Antibody
RC-4644-01 50 μL

Recombinant MAP3K2 Antibody

Sign In for Pricing
View Details
Recombinant MAP3K2 Antibody
RC-4644-02 100 µL

Recombinant MAP3K2 Antibody

Sign In for Pricing
View Details
Recombinant MAP3K2 Antibody
RC-4644-03 1 mL

Recombinant MAP3K2 Antibody

Sign In for Pricing
View Details
TESK1 (Center) Rabbit Polyclonal Antibody
AP54219PU-N 400 µL

TESK1 (Center) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Fmoc-L-cyclopropylalanine
TRC-F622780-250MG 250 mg

Fmoc-L-cyclopropylalanine

Sign In for Pricing
View Details