Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Influenza A virus Matrix protein 2 (M)

This Recombinant Influenza A virus Matrix protein 2 (M) spans the amino acid sequence from region 1-90.

Product Specifications

Product Name Alternative

Matrix protein 2, Proton channel protein M2

UniProt

Q6DPU3

Expression Region

1-90

Origin

Influenza A virus (strain A/Guinea fowl/Hong Kong/38/2002 H5N1 genotype X0)

Field of Research

Infectious Disease & Virology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

ETPTRTGWECKCSDSSDPLVVAASIIGILHLILWILDRLFFKCIYRRLKYGLKRGPSTGG VPESMREEYRQEQQSAVDVDDGHFVNIELE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Proser3 Mouse Gene Knockout Kit (CRISPR)
KN502058 1 Kit

Proser3 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
ANKRD24 Human Gene Knockout Kit (CRISPR)
KN423342 1 Kit

ANKRD24 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
RAP2B (NM_002886) Human Over-expression Lysate
LY419033 100 µg

RAP2B (NM_002886) Human Over-expression Lysate

Sign In for Pricing
View Details
PE/Cyanine5 Anti-Human CD27 Antibody[O323]
E-AB-F1140G-01 20 Tests

PE/Cyanine5 Anti-Human CD27 Antibody[O323]

Sign In for Pricing
View Details
PE/Cyanine5 Anti-Human CD27 Antibody[O323]
E-AB-F1140G-02 100 Tests

PE/Cyanine5 Anti-Human CD27 Antibody[O323]

Sign In for Pricing
View Details
PE/Cyanine5 Anti-Human CD27 Antibody[O323]
E-AB-F1140G-03 2x 100 Tests

PE/Cyanine5 Anti-Human CD27 Antibody[O323]

Sign In for Pricing
View Details