Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Influenza A virus Matrix protein 2 (M)

This Recombinant Influenza A virus Matrix protein 2 (M) spans the amino acid sequence from region 1-90.

Product Specifications

Product Name Alternative

Matrix protein 2, Proton channel protein M2

UniProt

Q6DPU3

Expression Region

1-90

Origin

Influenza A virus (strain A/Guinea fowl/Hong Kong/38/2002 H5N1 genotype X0)

Field of Research

Infectious Disease & Virology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

ETPTRTGWECKCSDSSDPLVVAASIIGILHLILWILDRLFFKCIYRRLKYGLKRGPSTGG VPESMREEYRQEQQSAVDVDDGHFVNIELE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Cars2 Mouse Gene Knockout Kit (CRISPR)
KN502552 1 Kit

Cars2 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
CHMP7 Polyclonal Antibody
E-AB-90807-01 60 µL

CHMP7 Polyclonal Antibody

Sign In for Pricing
View Details
CHMP7 Polyclonal Antibody
E-AB-90807-02 120 µL

CHMP7 Polyclonal Antibody

Sign In for Pricing
View Details
CHMP7 Polyclonal Antibody
E-AB-90807-03 200 µL

CHMP7 Polyclonal Antibody

Sign In for Pricing
View Details
PD-L1 Recombinant Rabbit Monoclonal Antibody [PSH08-56]
HA723002 100 µL

PD-L1 Recombinant Rabbit Monoclonal Antibody [PSH08-56]

Sign In for Pricing
View Details
Human BACH2 activation kit by CRISPRa
GA111849 1 Kit

Human BACH2 activation kit by CRISPRa

Sign In for Pricing
View Details