Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Schizosaccharomyces pombe Putative uncharacterized membrane protein PB18E9.05c (SPAPB18E9.05c)

This Recombinant Schizosaccharomyces pombe Putative uncharacterized membrane protein PB18E9.05c (SPAPB18E9.05c) spans the amino acid sequence from region 1-90.

Product Specifications

Product Name Alternative

Putative uncharacterized membrane protein PB18E9.05c

UniProt

Q8TFG3

Expression Region

1-90

Origin

Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast)

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MNEVISQPPCNIFRPLILSMHLSPVSILSPVLLIYLVIHSQNELVSMSWLFRSTICFGVS LFLSFFLVRILWGIAYSYNSNSMSIYFSYI

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Hs6st2 (NM_001077202) Mouse Tagged Lenti ORF Clone
MR215964L3 10 µg

Hs6st2 (NM_001077202) Mouse Tagged Lenti ORF Clone

Sign In for Pricing
View Details
Rabbit Polyclonal MLYCD Antibody
NBP1-83247 0.1 mL

Rabbit Polyclonal MLYCD Antibody

Sign In for Pricing
View Details
SLC5A1  polyclonal antibody
BS79711 50ul

SLC5A1 polyclonal antibody

Sign In for Pricing
View Details
Anti-CD14 (Rabbit, Monoclonal)
A100304 100 µL

Anti-CD14 (Rabbit, Monoclonal)

Sign In for Pricing
View Details
RPL21 (NM_000982) Human Untagged Clone
SC119489 10 µg

RPL21 (NM_000982) Human Untagged Clone

Sign In for Pricing
View Details
GALR1 Polyclonal Antibody, AbBy Fluor™ 405 Conjugated
bs-9927R-BF405 100 µL

GALR1 Polyclonal Antibody, AbBy Fluor™ 405 Conjugated

Sign In for Pricing
View Details