Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Cercopithecine herpesvirus 1 Envelope protein US9 homolog

This Recombinant Cercopithecine herpesvirus 1 Envelope protein US9 homolog spans the amino acid sequence from region 1-90.

Product Specifications

Product Name Alternative

Envelope protein US9 homolog, 10 kDa protein

UniProt

P30025

Expression Region

1-90

Origin

Cercopithecine herpesvirus 1 (CeHV-1) (Simian herpes B virus)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MEPLRLADAESLLSETSVIPLTPPAQTPEAYYTESDDETAADFLVRMGRQQTAIRRRRRQ TRAAGFVAAFVLVALISGGLGALMCWLAYR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Reynosin
TRC-R677230-25MG 25 mg

Reynosin

Sign In for Pricing
View Details
UBE3A Recombinant Rabbit Monoclonal Antibody [JE32-48]
HA721921 100 µL

UBE3A Recombinant Rabbit Monoclonal Antibody [JE32-48]

Sign In for Pricing
View Details
Human RBP4 Recombinant Rabbit monoclonal Antibody
HA723689 100 µL

Human RBP4 Recombinant Rabbit monoclonal Antibody

Sign In for Pricing
View Details
FGFR3 (NM_000142) Human Over-expression Lysate
LY424902 100 µg

FGFR3 (NM_000142) Human Over-expression Lysate

Sign In for Pricing
View Details
Plexin A3 (PLXNA3) Rabbit Polyclonal Antibody
TA380066 100 µL

Plexin A3 (PLXNA3) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
4-Hydroxychlorpropham Sulfate Sodium Salt
TRC-H825075-50MG 50 mg

4-Hydroxychlorpropham Sulfate Sodium Salt

Sign In for Pricing
View Details