Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Cercopithecine herpesvirus 1 Envelope protein US9 homolog

This Recombinant Cercopithecine herpesvirus 1 Envelope protein US9 homolog spans the amino acid sequence from region 1-90.

Product Specifications

Product Name Alternative

Envelope protein US9 homolog, 10 kDa protein

UniProt

P30025

Expression Region

1-90

Origin

Cercopithecine herpesvirus 1 (CeHV-1) (Simian herpes B virus)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MEPLRLADAESLLSETSVIPLTPPAQTPEAYYTESDDETAADFLVRMGRQQTAIRRRRRQ TRAAGFVAAFVLVALISGGLGALMCWLAYR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Catenin, beta (CTNNB1) (rCTNNB1/2173), CF488A conjugate, 0.1mg/mL
BNC882173-100 1x 100 µL

Catenin, beta (CTNNB1) (rCTNNB1/2173), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Multi-Well Plates
DP2MUR-9-N 50 Pack/Case

Multi-Well Plates

Sign In for Pricing
View Details
ZNF3 (NM_001278290) Human Tagged ORF Clone
RG238280 10 µg

ZNF3 (NM_001278290) Human Tagged ORF Clone

Sign In for Pricing
View Details
PEF1 Rabbit Polyclonal Antibody
TA361664 100 µL

PEF1 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
NEDD9 Antibody
KC-7703-01 50 μL

NEDD9 Antibody

Sign In for Pricing
View Details
NEDD9 Antibody
KC-7703-02 100 µL

NEDD9 Antibody

Sign In for Pricing
View Details