Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Cercopithecine herpesvirus 1 Envelope protein US9 homolog

This Recombinant Cercopithecine herpesvirus 1 Envelope protein US9 homolog spans the amino acid sequence from region 1-90.

Product Specifications

Product Name Alternative

Envelope protein US9 homolog, 10 kDa protein

UniProt

P30025

Expression Region

1-90

Origin

Cercopithecine herpesvirus 1 (CeHV-1) (Simian herpes B virus)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MEPLRLADAESLLSETSVIPLTPPAQTPEAYYTESDDETAADFLVRMGRQQTAIRRRRRQ TRAAGFVAAFVLVALISGGLGALMCWLAYR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human IgG Immunoglobulin (ICO-97), CF647 conjugate, 0.1mg/mL
BNC470758-500 1x 500 µL

Human IgG Immunoglobulin (ICO-97), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Biotin-PEO3-AMINE
#90067 1x 10 mg

Biotin-PEO3-AMINE

Sign In for Pricing
View Details
Them6 (NM_198607) Mouse Tagged ORF Clone
MG202196 10 µg

Them6 (NM_198607) Mouse Tagged ORF Clone

Sign In for Pricing
View Details
ProPette™ LE Single Channel Pipettor
P5200-5M 1 Each

ProPette™ LE Single Channel Pipettor

Sign In for Pricing
View Details
CD20 (B9E9), Biotin conjugate, 0.1mg/mL
BNCB0160-100 1x 100 µL

CD20 (B9E9), Biotin conjugate, 0.1mg/mL

Sign In for Pricing
View Details
AHI1-DT Antibody
KC-36216-01 50 μL

AHI1-DT Antibody

Sign In for Pricing
View Details