Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Uncharacterized protein Rv0879c/MT0902 (Rv0879c, MT0902)

This Recombinant Uncharacterized protein Rv0879c/MT0902 (Rv0879c, MT0902) spans the amino acid sequence from region 1-91.

Product Specifications

Product Name Alternative

Uncharacterized protein Rv0879c/MT0902

UniProt

P64735

Expression Region

1-91

Origin

Mycobacterium tuberculosis

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSVENSQIREPPPLPPVLLEVWPVIAVGALAWLVAAVAAFVVPGLASWRPVTVAGLATGL LGTTIFVWQLAAARRGARGAQAGLETYLDPK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

FCN3 (C-term) Rabbit Polyclonal Antibody
AP51643PU-N 400 µL

FCN3 (C-term) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
DMC1 (2H12/4), CF647 conjugate, 0.1mg/mL
BNC472178-500 1x 500 µL

DMC1 (2H12/4), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Phospho-AKT (S473) Recombinant Rabbit monoclonal Antibody
HA750132 100 µL

Phospho-AKT (S473) Recombinant Rabbit monoclonal Antibody

Sign In for Pricing
View Details
Frozen Tissue Sections, Spleen
CS627750 5x 5 µm

Frozen Tissue Sections, Spleen

Sign In for Pricing
View Details
CYP24A1 Rabbit Polyclonal Antibody
AP06772PU-N 100 µg

CYP24A1 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Glutaredoxin 1 (GLRX) (NM_001118890) Human Over-expression Lysate
LC426531 20 µg

Glutaredoxin 1 (GLRX) (NM_001118890) Human Over-expression Lysate

Sign In for Pricing
View Details