Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Uncharacterized protein Rv0879c/MT0902 (Rv0879c, MT0902)

This Recombinant Uncharacterized protein Rv0879c/MT0902 (Rv0879c, MT0902) spans the amino acid sequence from region 1-91.

Product Specifications

Product Name Alternative

Uncharacterized protein Rv0879c/MT0902

UniProt

P64735

Expression Region

1-91

Origin

Mycobacterium tuberculosis

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSVENSQIREPPPLPPVLLEVWPVIAVGALAWLVAAVAAFVVPGLASWRPVTVAGLATGL LGTTIFVWQLAAARRGARGAQAGLETYLDPK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Cytokeratin 17 Mouse Monoclonal Antibody [A2B9]
EM1901-28 100 µL

Cytokeratin 17 Mouse Monoclonal Antibody [A2B9]

Sign In for Pricing
View Details
Lauroylamide Propylbetaine
TRC-L178620-250MG 250 mg

Lauroylamide Propylbetaine

Sign In for Pricing
View Details
MEK4 (MAP2K4) Rabbit Polyclonal Antibody
AP20270PU-N 100 µg

MEK4 (MAP2K4) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
CNG3 (CNGA3) (NM_001298) Human Over-expression Lysate
LC420024 20 µg

CNG3 (CNGA3) (NM_001298) Human Over-expression Lysate

Sign In for Pricing
View Details
Tyrosinase (Melanoma Marker) (TYR/2024R), 1mg/mL
BNUM2024-50 1x 50 µL

Tyrosinase (Melanoma Marker) (TYR/2024R), 1mg/mL

Sign In for Pricing
View Details
Smarcd3 Mouse Gene Knockout Kit (CRISPR)
KN516292 1 Kit

Smarcd3 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details