Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Uncharacterized protein Rv0879c/MT0902 (Rv0879c, MT0902)

This Recombinant Uncharacterized protein Rv0879c/MT0902 (Rv0879c, MT0902) spans the amino acid sequence from region 1-91.

Product Specifications

Product Name Alternative

Uncharacterized protein Rv0879c/MT0902

UniProt

P64735

Expression Region

1-91

Origin

Mycobacterium tuberculosis

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSVENSQIREPPPLPPVLLEVWPVIAVGALAWLVAAVAAFVVPGLASWRPVTVAGLATGL LGTTIFVWQLAAARRGARGAQAGLETYLDPK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TYMP Antibody
KC-26588-01 50 μL

TYMP Antibody

Sign In for Pricing
View Details
TYMP Antibody
KC-26588-02 100 µL

TYMP Antibody

Sign In for Pricing
View Details
TYMP Antibody
KC-26588-03 1 mL

TYMP Antibody

Sign In for Pricing
View Details
Human Apolipoprotein M (APOM) activation kit by CRISPRa
GA111067 1 Kit

Human Apolipoprotein M (APOM) activation kit by CRISPRa

Sign In for Pricing
View Details
Abcd2 Mouse Gene Knockout Kit (CRISPR)
KN500632 1 Kit

Abcd2 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Dystrophia myotonica protein kinase (DMPK) (NM_004409) Human Recombinant Protein
TP309151 20 µg

Dystrophia myotonica protein kinase (DMPK) (NM_004409) Human Recombinant Protein

Sign In for Pricing
View Details