Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Uncharacterized protein Mb0903c (Mb0903c)

This Recombinant Uncharacterized protein Mb0903c (Mb0903c) spans the amino acid sequence from region 1-91.

Product Specifications

Product Name Alternative

Uncharacterized protein Mb0903c

UniProt

P64736

Expression Region

1-91

Origin

Mycobacterium bovis

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSVENSQIREPPPLPPVLLEVWPVIAVGALAWLVAAVAAFVVPGLASWRPVTVAGLATGL LGTTIFVWQLAAARRGARGAQAGLETYLDPK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lentiviral human FSHB sgRNA gene knockout kit - Lentiviral human FSHB sgRNA gene knockout kit (25)
GTR15396636 1 Vial

Lentiviral human FSHB sgRNA gene knockout kit - Lentiviral human FSHB sgRNA gene knockout kit (25)

Sign In for Pricing
View Details
CalreticULin (CALR) Human Gene Knockout Kit (CRISPR)
KN203222LP 1 Kit

CalreticULin (CALR) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
AKR1B1 (Aldose Reductase, AR, Aldehyde Reductase, Aldo-keto Reductase Family 1 Member B1, ALDR1) (APC)
123153-APC 100 µL

AKR1B1 (Aldose Reductase, AR, Aldehyde Reductase, Aldo-keto Reductase Family 1 Member B1, ALDR1) (APC)

Sign In for Pricing
View Details
Mouse Lunatic Fringe/LFNG (NP_032520) VersaClone cDNA
RDC1733 10 µg

Mouse Lunatic Fringe/LFNG (NP_032520) VersaClone cDNA

Sign In for Pricing
View Details
GATAD2B, NT (GATAD2B, KIAA1150, Transcriptional repressor p66-beta, GATA zinc finger domain-containing protein 2B, p66/p68) (MaxLight 405)
MBS6301362-01 0.1 mL

GATAD2B, NT (GATAD2B, KIAA1150, Transcriptional repressor p66-beta, GATA zinc finger domain-containing protein 2B, p66/p68) (MaxLight 405)

Sign In for Pricing
View Details
GATAD2B, NT (GATAD2B, KIAA1150, Transcriptional repressor p66-beta, GATA zinc finger domain-containing protein 2B, p66/p68) (MaxLight 405)
MBS6301362-02 5x 0.1 mL

GATAD2B, NT (GATAD2B, KIAA1150, Transcriptional repressor p66-beta, GATA zinc finger domain-containing protein 2B, p66/p68) (MaxLight 405)

Sign In for Pricing
View Details