Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Uncharacterized protein Mb0903c (Mb0903c)

This Recombinant Uncharacterized protein Mb0903c (Mb0903c) spans the amino acid sequence from region 1-91.

Product Specifications

Product Name Alternative

Uncharacterized protein Mb0903c

UniProt

P64736

Expression Region

1-91

Origin

Mycobacterium bovis

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSVENSQIREPPPLPPVLLEVWPVIAVGALAWLVAAVAAFVVPGLASWRPVTVAGLATGL LGTTIFVWQLAAARRGARGAQAGLETYLDPK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

WOX9 Antibody
orb798573 2 mg

WOX9 Antibody

Sign In for Pricing
View Details
TMEFF2 Antibody
A36743-100UL 100 µL

TMEFF2 Antibody

Sign In for Pricing
View Details
C9orf68 Lentiviral Vector (Human) (EF1a) (pLenti-GIII-EF1a)
LV810404 1.0 µg DNA

C9orf68 Lentiviral Vector (Human) (EF1a) (pLenti-GIII-EF1a)

Sign In for Pricing
View Details
RNASEK Human Over-expression Lysate
orb1362646 20 µg

RNASEK Human Over-expression Lysate

Sign In for Pricing
View Details
Clta Recombinant Protein
OPCA01526-100UG 100 µg

Clta Recombinant Protein

Sign In for Pricing
View Details
P66 beta (GATAD2B) (NM_020699) Human Over-expression Lysate
LS057459-100ug 100 µg

P66 beta (GATAD2B) (NM_020699) Human Over-expression Lysate

Sign In for Pricing
View Details