Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Pelobacter propionicus ATP synthase subunit c 1 (atpE1)

This Recombinant Pelobacter propionicus ATP synthase subunit c 1 (atpE1) spans the amino acid sequence from region 1-91.

Product Specifications

Product Name Alternative

ATP synthase subunit c 1, ATP synthase F (0) sector subunit c 1, F-type ATPase subunit c 1, F-ATPase subunit c 1, Lipid-binding protein 1

UniProt

A1ALL1

Expression Region

1-91

Origin

Pelobacter propionicus (strain DSM 2379)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MNFFTMCVFGAAIGMAIGTLGTAIGQGMAVKSAVEGVARNPGAASKIMTTMMIGLAMIES LAIYALVVCLIILFANPYKDIALKMVETVAK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ELK3 Protein Vector (Mouse) (pPB-C-His)
PV175342 500 ng

ELK3 Protein Vector (Mouse) (pPB-C-His)

Sign In for Pricing
View Details
Rno-miR-196b-5p miRNA Mimic
orb1874090-01 5 nmol

Rno-miR-196b-5p miRNA Mimic

Sign In for Pricing
View Details
Rno-miR-196b-5p miRNA Mimic
orb1874090-02 10 nmol

Rno-miR-196b-5p miRNA Mimic

Sign In for Pricing
View Details
Methyl 2-{3-[ (methylamino) methyl]phenoxy}acetate hydrochloride
KQD93302-01 50 mg

Methyl 2-{3-[ (methylamino) methyl]phenoxy}acetate hydrochloride

Sign In for Pricing
View Details
Methyl 2-{3-[ (methylamino) methyl]phenoxy}acetate hydrochloride
KQD93302-02 0.5 g

Methyl 2-{3-[ (methylamino) methyl]phenoxy}acetate hydrochloride

Sign In for Pricing
View Details
Recombinant Human Chondromodulin-1/LECT1 Protein
NBP2-51539-0.5mg 0.5 mg

Recombinant Human Chondromodulin-1/LECT1 Protein

Sign In for Pricing
View Details