Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Pelobacter propionicus ATP synthase subunit c 1 (atpE1)

This Recombinant Pelobacter propionicus ATP synthase subunit c 1 (atpE1) spans the amino acid sequence from region 1-91.

Product Specifications

Product Name Alternative

ATP synthase subunit c 1, ATP synthase F (0) sector subunit c 1, F-type ATPase subunit c 1, F-ATPase subunit c 1, Lipid-binding protein 1

UniProt

A1ALL1

Expression Region

1-91

Origin

Pelobacter propionicus (strain DSM 2379)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MNFFTMCVFGAAIGMAIGTLGTAIGQGMAVKSAVEGVARNPGAASKIMTTMMIGLAMIES LAIYALVVCLIILFANPYKDIALKMVETVAK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

APC Recombinant Antibody, AbBy Fluor™ 350 Conjugated
bsm-61249R-BF350-01 20 µL

APC Recombinant Antibody, AbBy Fluor™ 350 Conjugated

Sign In for Pricing
View Details
APC Recombinant Antibody, AbBy Fluor™ 350 Conjugated
bsm-61249R-BF350-02 100 µL

APC Recombinant Antibody, AbBy Fluor™ 350 Conjugated

Sign In for Pricing
View Details
Phospho-ATF-2 (S112)
328307-01 50 µg

Phospho-ATF-2 (S112)

Sign In for Pricing
View Details
Phospho-ATF-2 (S112)
328307-02 100 µg

Phospho-ATF-2 (S112)

Sign In for Pricing
View Details
Olfactory receptor 4C15 (OR4C15) Antibody (HRP)
abx348151-01 50 µL

Olfactory receptor 4C15 (OR4C15) Antibody (HRP)

Sign In for Pricing
View Details
Olfactory receptor 4C15 (OR4C15) Antibody (HRP)
abx348151-02 100 µL

Olfactory receptor 4C15 (OR4C15) Antibody (HRP)

Sign In for Pricing
View Details