Recombinant Geobacter lovleyi ATP synthase subunit c (atpE)
This Recombinant Geobacter lovleyi ATP synthase subunit c (atpE) spans the amino acid sequence from region 1-91.
Product Specifications
Product Name Alternative
ATP synthase subunit c, ATP synthase F (0) sector subunit c, F-type ATPase subunit c, F-ATPase subunit c, Lipid-binding protein
UniProt
B3E9X4
Expression Region
1-91
Origin
Geobacter lovleyi (strain ATCC BAA-1151 / DSM 17278 / SZ)
Field of Research
Metabolism Research
Form
Lyophilized powder
Storage Conditions
Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week
Notes
For research use only.
Preservative
Tris/PBS-based buffer, 6% Trehalose, pH 8.0
AA Sequence
MNFFTMCMLAAGFGMAIGAFGTGIGQGLAVKSAVEGVSRNPGASGKILTTMMIGLAMIES LAIYVLVVCLIILFANPYKDVAIKALETVAK
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
GA104502 1 Kit
Human Solute carrier family 22 member 5 (SLC22A5) activation kit by CRISPRa
Sign In for Pricing
View Details 
TP308546L 1 mg
ZNF179 (RNF112) (NM_007148) Human Recombinant Protein
Sign In for Pricing
View Details 
