Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Geobacter bemidjiensis ATP synthase subunit c (atpE)

This Recombinant Geobacter bemidjiensis ATP synthase subunit c (atpE) spans the amino acid sequence from region 1-91.

Product Specifications

Product Name Alternative

ATP synthase subunit c, ATP synthase F (0) sector subunit c, F-type ATPase subunit c, F-ATPase subunit c, Lipid-binding protein

UniProt

B5EFG9

Expression Region

1-91

Origin

Geobacter bemidjiensis (strain Bem / ATCC BAA-1014 / DSM 16622)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MEFFTMCVLAAGIGMALGTLGTGIGQGLAVKSAVEGTSRNPGASGKILTTMMIGLAMIES LAIYALVVCLIILFANPYKDIALELAKSVAK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ISX9
SIH-628-25MG 25 mg

ISX9

Sign In for Pricing
View Details
Human LYSMD1 activation kit by CRISPRa
GA117989 1 Kit

Human LYSMD1 activation kit by CRISPRa

Sign In for Pricing
View Details
MTF1 (MTF1/2649), CF740 conjugate, 0.1mg/mL
BNC742649-100 1x 100 µL

MTF1 (MTF1/2649), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
General Purpose Incubator BIGP-302
BIGP-302 1 Unit

General Purpose Incubator BIGP-302

Sign In for Pricing
View Details
Frozen Tissue Sections, Urinary bladder
CS505382 5x 5 µm

Frozen Tissue Sections, Urinary bladder

Sign In for Pricing
View Details
Istradefylline
TRC-I927000-500MG 500 mg

Istradefylline

Sign In for Pricing
View Details