Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Geobacter sp. ATP synthase subunit c (atpE)

This Recombinant Geobacter sp. ATP synthase subunit c (atpE) spans the amino acid sequence from region 1-91.

Product Specifications

Product Name Alternative

ATP synthase subunit c, ATP synthase F (0) sector subunit c, F-type ATPase subunit c, F-ATPase subunit c, Lipid-binding protein

UniProt

C6E8P1

Expression Region

1-91

Origin

Geobacter sp. (strain M21)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MEFFTMCVLAAGIGMALGTLGTGIGQGLAVKSAVEGTSRNPGASGKILTTMMIGLAMIES LAIYALVVCLIILFANPYKDIALELAKSVAK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

1-Hydroxypyrene-d9
TRC-H952702-2.5MG 2.5 mg

1-Hydroxypyrene-d9

Sign In for Pricing
View Details
3-Chloro-5-fluorobenzoic acid
TRC-C584780-250MG 250 mg

3-Chloro-5-fluorobenzoic acid

Sign In for Pricing
View Details
20(S)-Ginsenoside Rg2
TRC-G387580-50MG 50 mg

20(S)-Ginsenoside Rg2

Sign In for Pricing
View Details
Tissue Total RNA, Lung: right middle lobe
CR560995 5 µg

Tissue Total RNA, Lung: right middle lobe

Sign In for Pricing
View Details
SNF5 (SMARCB1) Human Gene Knockout Kit (CRISPR)
KN217885RB 1 Kit

SNF5 (SMARCB1) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
RAE1 (NM_001015885) Human Recombinant Protein
TP310733 20 µg

RAE1 (NM_001015885) Human Recombinant Protein

Sign In for Pricing
View Details