Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Geobacter sp. ATP synthase subunit c (atpE)

This Recombinant Geobacter sp. ATP synthase subunit c (atpE) spans the amino acid sequence from region 1-91.

Product Specifications

Product Name Alternative

ATP synthase subunit c, ATP synthase F (0) sector subunit c, F-type ATPase subunit c, F-ATPase subunit c, Lipid-binding protein

UniProt

C6E8P1

Expression Region

1-91

Origin

Geobacter sp. (strain M21)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MEFFTMCVLAAGIGMALGTLGTGIGQGLAVKSAVEGTSRNPGASGKILTTMMIGLAMIES LAIYALVVCLIILFANPYKDIALELAKSVAK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Frozen Tissue Blocks, Myeloid tissue
CB630664 1 Block

Frozen Tissue Blocks, Myeloid tissue

Sign In for Pricing
View Details
ARHGEF7 (NM_145735) Human Recombinant Protein
TP318798L 1 mg

ARHGEF7 (NM_145735) Human Recombinant Protein

Sign In for Pricing
View Details
PEF1 (NM_012392) Human Over-expression Lysate
LC402204 20 µg

PEF1 (NM_012392) Human Over-expression Lysate

Sign In for Pricing
View Details
FLI1 Human Gene Knockout Kit (CRISPR)
KN200695 1 Kit

FLI1 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
SMKR1 Human Gene Knockout Kit (CRISPR)
KN430917 1 Kit

SMKR1 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
1,1,2,2,3,3,4,4,5,5,5-Undecafluoro-1-pentanesulfinic Acid Sodium Salt
TRC-U787550-5MG 5 mg

1,1,2,2,3,3,4,4,5,5,5-Undecafluoro-1-pentanesulfinic Acid Sodium Salt

Sign In for Pricing
View Details