Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Methanocaldococcus jannaschii Uncharacterized protein MJ0606 (MJ0606)

This Recombinant Methanocaldococcus jannaschii Uncharacterized protein MJ0606 (MJ0606) spans the amino acid sequence from region 1-91.

Product Specifications

Product Name Alternative

Uncharacterized protein MJ0606

UniProt

Q58023

Expression Region

1-91

Origin

Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) (Methanococcus jannaschii)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MDLEGKCCLIHAIGGIIFGYLANYVYTAGLGIFSGIATLIFLFIGAVIFGHISAKTFGEE SLTQKQWLGCGVLPFFLVAIVVWVLKFNGLI

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Bmp4 Mouse shRNA Lentiviral Particle (Locus ID 12159)
TL516759V 500 µL Each

Bmp4 Mouse shRNA Lentiviral Particle (Locus ID 12159)

Sign In for Pricing
View Details
Anti-Oncostatin M/Osm Antibody Picoband®, Dylight594 Conjugate
A00804-1-Dylight594 100 µg

Anti-Oncostatin M/Osm Antibody Picoband®, Dylight594 Conjugate

Sign In for Pricing
View Details
Piccolo Antibody Blocking Peptide
orb1515127 500 µg

Piccolo Antibody Blocking Peptide

Sign In for Pricing
View Details
Methyl 2- (4-bromo-2-oxo-1,2-dihydropyridin-1-yl) acetate
EQC67268-01 50 mg

Methyl 2- (4-bromo-2-oxo-1,2-dihydropyridin-1-yl) acetate

Sign In for Pricing
View Details
Methyl 2- (4-bromo-2-oxo-1,2-dihydropyridin-1-yl) acetate
EQC67268-02 0.5 g

Methyl 2- (4-bromo-2-oxo-1,2-dihydropyridin-1-yl) acetate

Sign In for Pricing
View Details
Anti-CD25 Antibody [BC96], PE-25Tests
QAB35-PE-25Tests 25Tests

Anti-CD25 Antibody [BC96], PE-25Tests

Sign In for Pricing
View Details