Recombinant Methanocaldococcus jannaschii Uncharacterized protein MJ0606 (MJ0606)
This Recombinant Methanocaldococcus jannaschii Uncharacterized protein MJ0606 (MJ0606) spans the amino acid sequence from region 1-91.
Product Specifications
Product Name Alternative
Uncharacterized protein MJ0606
UniProt
Q58023
Expression Region
1-91
Origin
Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) (Methanococcus jannaschii)
Form
Lyophilized powder
Storage Conditions
Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week
Notes
For research use only.
Preservative
Tris/PBS-based buffer, 6% Trehalose, pH 8.0
AA Sequence
MDLEGKCCLIHAIGGIIFGYLANYVYTAGLGIFSGIATLIFLFIGAVIFGHISAKTFGEE SLTQKQWLGCGVLPFFLVAIVVWVLKFNGLI
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
128251-ML550 100 µL
IFIT3 (Interferon-induced Protein with Tetratricopeptide Repeats 3, IFIT-3, CIG49, ISG-60, Interferon-induced 60kD Protein, IFI-60K, Interferon-induced Protein with Tetratricopeptide Repeats 4, IFIT-4, Retinoic Acid-induced Gene G-Protein, P60, RIG-G, CIG-49, IFI60, IFIT4, ISG60) (MaxLight 550)
Sign In for Pricing
View Details 