Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Methanocaldococcus jannaschii Uncharacterized protein MJ0606 (MJ0606)

This Recombinant Methanocaldococcus jannaschii Uncharacterized protein MJ0606 (MJ0606) spans the amino acid sequence from region 1-91.

Product Specifications

Product Name Alternative

Uncharacterized protein MJ0606

UniProt

Q58023

Expression Region

1-91

Origin

Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) (Methanococcus jannaschii)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MDLEGKCCLIHAIGGIIFGYLANYVYTAGLGIFSGIATLIFLFIGAVIFGHISAKTFGEE SLTQKQWLGCGVLPFFLVAIVVWVLKFNGLI

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Collagen IV Polyclonal Antibody, AbBy Fluor™ 647 Conjugated
bs-0806R-BF647 100 µL

Collagen IV Polyclonal Antibody, AbBy Fluor™ 647 Conjugated

Sign In for Pricing
View Details
ADAMTS18 Antibody
GWB-MT091A 50 µg

ADAMTS18 Antibody

Sign In for Pricing
View Details
Gp100 / Melanosome / PMEL17 / SILV (Melanoma Marker) (PMEL/2039), CF594 conjugate, 0.1mg/mL
BNC942039-500 1x 500 µL

Gp100 / Melanosome / PMEL17 / SILV (Melanoma Marker) (PMEL/2039), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Lenumlostat
E5824-5mg 5 mg

Lenumlostat

Sign In for Pricing
View Details
PSMB2 (Proteasome Subunit beta Type-2, HC7-I) (HRP)
MBS6433573-01 0.1 mL

PSMB2 (Proteasome Subunit beta Type-2, HC7-I) (HRP)

Sign In for Pricing
View Details
PSMB2 (Proteasome Subunit beta Type-2, HC7-I) (HRP)
MBS6433573-02 5x 0.1 mL

PSMB2 (Proteasome Subunit beta Type-2, HC7-I) (HRP)

Sign In for Pricing
View Details