Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Putative uncharacterized protein C1orf98 (C1orf98)

This Recombinant Human Putative uncharacterized protein C1orf98 (C1orf98) spans the amino acid sequence from region 1-91.

Product Specifications

Product Name Alternative

Putative uncharacterized protein C1orf98

UniProt

A6NCI5

Expression Region

1-91

Origin

Homo sapiens (Human)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MVCYLYWETFPSISHLLKITLSARDCHVCGLNLFIFMDPVENQALHPVIMALILMPSLHC FGNILILLFLKSPAQLFCRMSVDLALLFPHK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Sec61a1 sgRNA CRISPR/Cas9 All-in-One Lentivector (Rat) (Target 2)
K7022607 1.0 µg DNA

Sec61a1 sgRNA CRISPR/Cas9 All-in-One Lentivector (Rat) (Target 2)

Sign In for Pricing
View Details
Mouse G Protein Coupled Receptor 65 (GPR65) ELISA Kit
abx389369 96 Tests

Mouse G Protein Coupled Receptor 65 (GPR65) ELISA Kit

Sign In for Pricing
View Details
Methyl benzylcarbamate
FAA81770-01 0.5 g

Methyl benzylcarbamate

Sign In for Pricing
View Details
Methyl benzylcarbamate
FAA81770-02 5 g

Methyl benzylcarbamate

Sign In for Pricing
View Details
AVP Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV-RFP-2A-Puro)
LV688738 1.0 µg DNA

AVP Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV-RFP-2A-Puro)

Sign In for Pricing
View Details
(E) -5- (2,6,6-Trimethylcyclohex-1-en-1-yl) pent-4-en-2-ynenitrile
OR1031484-01 100 mg

(E) -5- (2,6,6-Trimethylcyclohex-1-en-1-yl) pent-4-en-2-ynenitrile

Sign In for Pricing
View Details