Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Putative uncharacterized protein C1orf98 (C1orf98)

This Recombinant Human Putative uncharacterized protein C1orf98 (C1orf98) spans the amino acid sequence from region 1-91.

Product Specifications

Product Name Alternative

Putative uncharacterized protein C1orf98

UniProt

A6NCI5

Expression Region

1-91

Origin

Homo sapiens (Human)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MVCYLYWETFPSISHLLKITLSARDCHVCGLNLFIFMDPVENQALHPVIMALILMPSLHC FGNILILLFLKSPAQLFCRMSVDLALLFPHK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

HLA-DQA2 Human Pre-designed siRNA Set A
HY-RS06206 1 Set

HLA-DQA2 Human Pre-designed siRNA Set A

Sign In for Pricing
View Details
Oas1a Double Nickase Plasmid (m2)
sc-434228-NIC-2 20 µg

Oas1a Double Nickase Plasmid (m2)

Sign In for Pricing
View Details
METTL21C AAV Vector (Human) (CMV)
28408101 1 µg

METTL21C AAV Vector (Human) (CMV)

Sign In for Pricing
View Details
GATA3 Polyclonal Antibody, AbBy Fluor™ 405 Conjugated
bs-23118R-BF405 100 µL

GATA3 Polyclonal Antibody, AbBy Fluor™ 405 Conjugated

Sign In for Pricing
View Details
C1QA-set siRNA/shRNA/RNAi Lentivector (Human)
14240091 4x 500 ng

C1QA-set siRNA/shRNA/RNAi Lentivector (Human)

Sign In for Pricing
View Details
DPYSL5 (Dihydropyrimidinase-related Protein 5, DRP-5, CRMP3-associated Molecule, CRAM, Collapsin Response Mediator Protein 5, CRMP-5, UNC33-like Phosphoprotein 6, ULIP-6, CRMP5, ULIP6) (AP) discontinued
126009-AP 100 µL

DPYSL5 (Dihydropyrimidinase-related Protein 5, DRP-5, CRMP3-associated Molecule, CRAM, Collapsin Response Mediator Protein 5, CRMP-5, UNC33-like Phosphoprotein 6, ULIP-6, CRMP5, ULIP6) (AP) discontinued

Sign In for Pricing
View Details