Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Putative uncharacterized protein C1orf98 (C1orf98)

This Recombinant Human Putative uncharacterized protein C1orf98 (C1orf98) spans the amino acid sequence from region 1-91.

Product Specifications

Product Name Alternative

Putative uncharacterized protein C1orf98

UniProt

A6NCI5

Expression Region

1-91

Origin

Homo sapiens (Human)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MVCYLYWETFPSISHLLKITLSARDCHVCGLNLFIFMDPVENQALHPVIMALILMPSLHC FGNILILLFLKSPAQLFCRMSVDLALLFPHK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

DNA Polymerase lambda Rabbit Polyclonal Antibody (FITC)
orb465487 100 µL

DNA Polymerase lambda Rabbit Polyclonal Antibody (FITC)

Sign In for Pricing
View Details
AUTS2 Protein Vector (Human) (pPM-N-D-C-HA)
PV325784 500 ng

AUTS2 Protein Vector (Human) (pPM-N-D-C-HA)

Sign In for Pricing
View Details
Rabbit anti-human Interleukin-13 receptor subunit alpha-2 polyclonal Antibody(IL13RA2)
MBS1498621-01 0.05 mL

Rabbit anti-human Interleukin-13 receptor subunit alpha-2 polyclonal Antibody(IL13RA2)

Sign In for Pricing
View Details
Rabbit anti-human Interleukin-13 receptor subunit alpha-2 polyclonal Antibody(IL13RA2)
MBS1498621-02 0.1 mL

Rabbit anti-human Interleukin-13 receptor subunit alpha-2 polyclonal Antibody(IL13RA2)

Sign In for Pricing
View Details
Rabbit anti-human Interleukin-13 receptor subunit alpha-2 polyclonal Antibody(IL13RA2)
MBS1498621-03 5x 0.1 mL

Rabbit anti-human Interleukin-13 receptor subunit alpha-2 polyclonal Antibody(IL13RA2)

Sign In for Pricing
View Details
Mouse Neuropeptide Y Receptor Y1 (NPY1R) ELISA Kit
RD-NPY1R-Mu-01 96 Tests

Mouse Neuropeptide Y Receptor Y1 (NPY1R) ELISA Kit

Sign In for Pricing
View Details