Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Bacillus subtilis Uncharacterized protein ynaG (ynaG)

This Recombinant Bacillus subtilis Uncharacterized protein ynaG (ynaG) spans the amino acid sequence from region 1-91.

Product Specifications

Product Name Alternative

Uncharacterized protein ynaG

UniProt

P94485

Expression Region

1-91

Origin

Bacillus subtilis (strain 168)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MNVKKAAAVFSITIPIISAILIINFFTGFMSIPWQGMPVFFPLLLSPIGIILAFVSIKTN KRCAVYGIVLNAIMFPFPFFWFIGGALLFGV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MEF2A (Myocyte-specific Enhancer Factor 2A, Serum Response Factor-like Protein 1, MEF2)
MBS630097-01 0.05 mg

MEF2A (Myocyte-specific Enhancer Factor 2A, Serum Response Factor-like Protein 1, MEF2)

Sign In for Pricing
View Details
MEF2A (Myocyte-specific Enhancer Factor 2A, Serum Response Factor-like Protein 1, MEF2)
MBS630097-02 5x 0.05 mg

MEF2A (Myocyte-specific Enhancer Factor 2A, Serum Response Factor-like Protein 1, MEF2)

Sign In for Pricing
View Details
GRID1 Antibody
CSB-PA009902GA01HU 100 µL

GRID1 Antibody

Sign In for Pricing
View Details
N myc interactor Mouse Monoclonal Antibody
BF8595-01 100 µL

N myc interactor Mouse Monoclonal Antibody

Sign In for Pricing
View Details
N myc interactor Mouse Monoclonal Antibody
BF8595-02 200 µL

N myc interactor Mouse Monoclonal Antibody

Sign In for Pricing
View Details
GFAP (Glial Fibrillary Acidic Protein) (Biotin)
MBS6248966-01 0.1 mL

GFAP (Glial Fibrillary Acidic Protein) (Biotin)

Sign In for Pricing
View Details