Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Bacillus subtilis Uncharacterized protein ynaG (ynaG)

This Recombinant Bacillus subtilis Uncharacterized protein ynaG (ynaG) spans the amino acid sequence from region 1-91.

Product Specifications

Product Name Alternative

Uncharacterized protein ynaG

UniProt

P94485

Expression Region

1-91

Origin

Bacillus subtilis (strain 168)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MNVKKAAAVFSITIPIISAILIINFFTGFMSIPWQGMPVFFPLLLSPIGIILAFVSIKTN KRCAVYGIVLNAIMFPFPFFWFIGGALLFGV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Human CD160 Protein, C-His
MBS1578738-01 0.1 mg

Recombinant Human CD160 Protein, C-His

Sign In for Pricing
View Details
Recombinant Human CD160 Protein, C-His
MBS1578738-02 1 mg

Recombinant Human CD160 Protein, C-His

Sign In for Pricing
View Details
Recombinant Human CD160 Protein, C-His
MBS1578738-03 5x 1 mg

Recombinant Human CD160 Protein, C-His

Sign In for Pricing
View Details
(E) -3-[2- (7-Chloro-2-quinolinyl) ethenyl]benzaldehyde
FC20039-01 25 mg

(E) -3-[2- (7-Chloro-2-quinolinyl) ethenyl]benzaldehyde

Sign In for Pricing
View Details
(E) -3-[2- (7-Chloro-2-quinolinyl) ethenyl]benzaldehyde
FC20039-02 50 mg

(E) -3-[2- (7-Chloro-2-quinolinyl) ethenyl]benzaldehyde

Sign In for Pricing
View Details
SNU-182 Cells
116276 1 Vial

SNU-182 Cells

Sign In for Pricing
View Details