Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant ATP synthase lipid-binding protein, mitochondrial (CBG11706)

This Recombinant ATP synthase lipid-binding protein, mitochondrial (CBG11706) spans the amino acid sequence from region 25-116.

Product Specifications

Product Name Alternative

ATP synthase lipid-binding protein, mitochondrial, ATPase protein 9, ATPase subunit c

UniProt

A8XDX2

Expression Region

25-116

Origin

Caenorhabditis briggsae

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MENAVAARMISTTVARKDIDSAAKYIGAGAATVGVAGSGAGIGNVFGALVIGYARNPSLK QQLFSYAILGFALSEAMGLFCLTMGFMILFAL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

L-Ascorbic Acid-13C6
TRC-A786992-1MG 1 mg

L-Ascorbic Acid-13C6

Sign In for Pricing
View Details
Frozen Tissue Sections, Colon
CS632174 5x 5 µm

Frozen Tissue Sections, Colon

Sign In for Pricing
View Details
Tissue FFPE Sections, Kidney
CS710244 5x 5 µm

Tissue FFPE Sections, Kidney

Sign In for Pricing
View Details
MYT1L Human Gene Knockout Kit (CRISPR)
KN421586 1 Kit

MYT1L Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Human WDR20 activation kit by CRISPRa
GA114159 1 Kit

Human WDR20 activation kit by CRISPRa

Sign In for Pricing
View Details
OTX2 Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI1A1]
TA809511BM 100 µL

OTX2 Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI1A1]

Sign In for Pricing
View Details